Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Na (+) /H (+) antiporter subunit G

This Recombinant Bacillus subtilis Na (+) /H (+) antiporter subunit G spans the amino acid sequence from region 1-124.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit G, Mrp complex subunit G, Multiple resistance and pH homeostasis protein G

UniProt

O05227

Expression Region

1-124

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIETAKVVVAVFILLGALICLIASFGVLRLPDVFTRAHAASKGSTLGVNMILLGVFFYLW FVTGELSAKILLGILFIFITSPIGGHLICRAAYNSGVKLDERSVQDDYNGIRNFVIKRKE DSYL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LYRM5 (ETFRF1) (NM_001001660) Human Over-expression Lysate
LY424231 100 µg

LYRM5 (ETFRF1) (NM_001001660) Human Over-expression Lysate

Sign In for Pricing
View Details
Endoglin / CD105 (ENG/1621), 0.2mg/mL
BNUB1621-100 1x 100 µL

Endoglin / CD105 (ENG/1621), 0.2mg/mL

Sign In for Pricing
View Details
ACSL6 (NM_001009185) Human Recombinant Protein
TP311883M 100 µg

ACSL6 (NM_001009185) Human Recombinant Protein

Sign In for Pricing
View Details
Importin 8 (IPO8) Human Gene Knockout Kit (CRISPR)
KN415167 1 Kit

Importin 8 (IPO8) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ADAMTS2 Rabbit Polyclonal Antibody
TA363606 100 µL

ADAMTS2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD41a (ITGA2B/1036), 0.2mg/mL
BNUB1036-100 1x 100 µL

CD41a (ITGA2B/1036), 0.2mg/mL

Sign In for Pricing
View Details