Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized protein yoqO (yoqO)

This Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized protein yoqO (yoqO) spans the amino acid sequence from region 1-124.

Product Specifications

Product Name Alternative

SPBc2 prophage-derived uncharacterized protein yoqO

UniProt

O31923

Expression Region

1-124

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKTIGITGFFLSIVVQSFSANDSLSHKIATGLLFVSIAIYNFDHAKDYSKASLVVICLT FFVLALGIHKLLSFSSDLFDNVNINFGVIFILQITLIIGSVAIAISIMKFICDRLKKKPN GKEC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

anti-Indoleamine 2, 3-dioxygenase
YF-PA12740 100 ug

anti-Indoleamine 2, 3-dioxygenase

Sign In for Pricing
View Details
Pias1 (NM_019663) Mouse Tagged ORF Clone Lentiviral Particle
MR209770L3V 200 µL

Pias1 (NM_019663) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse Defa33 (NM_001270555) AAV Particle
MR227815A1V 250 µL

Mouse Defa33 (NM_001270555) AAV Particle

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana F-box/kelch-repeat protein At3g13680 (At3g13680)
MBS1358918-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana F-box/kelch-repeat protein At3g13680 (At3g13680)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana F-box/kelch-repeat protein At3g13680 (At3g13680)
MBS1358918-02 0.02 mg (Yeast)

Recombinant Arabidopsis thaliana F-box/kelch-repeat protein At3g13680 (At3g13680)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana F-box/kelch-repeat protein At3g13680 (At3g13680)
MBS1358918-03 0.1 mg (E-Coli)

Recombinant Arabidopsis thaliana F-box/kelch-repeat protein At3g13680 (At3g13680)

Sign In for Pricing
View Details