Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized protein yoqO (yoqO)

This Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized protein yoqO (yoqO) spans the amino acid sequence from region 1-124.

Product Specifications

Product Name Alternative

SPBc2 prophage-derived uncharacterized protein yoqO

UniProt

O31923

Expression Region

1-124

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKTIGITGFFLSIVVQSFSANDSLSHKIATGLLFVSIAIYNFDHAKDYSKASLVVICLT FFVLALGIHKLLSFSSDLFDNVNINFGVIFILQITLIIGSVAIAISIMKFICDRLKKKPN GKEC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Melanoma Marker A (MMA) ELISA Kit
EIA06031Bo 1 Kit

Bovine Melanoma Marker A (MMA) ELISA Kit

Sign In for Pricing
View Details
Bovine Matrix Metalloproteinase 7 ELISA Kit (MMP7)
RK00492 96 Tests

Bovine Matrix Metalloproteinase 7 ELISA Kit (MMP7)

Sign In for Pricing
View Details
Hamster Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 ELISA Kit
MBS7273244-01 48 Well

Hamster Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 ELISA Kit

Sign In for Pricing
View Details
Hamster Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 ELISA Kit
MBS7273244-02 96 Well

Hamster Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 ELISA Kit

Sign In for Pricing
View Details
Hamster Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 ELISA Kit
MBS7273244-03 5x 96 Well

Hamster Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 ELISA Kit

Sign In for Pricing
View Details
Hamster Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 ELISA Kit
MBS7273244-04 10x 96 Well

Hamster Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 ELISA Kit

Sign In for Pricing
View Details