Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized protein yoqO (yoqO)

This Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized protein yoqO (yoqO) spans the amino acid sequence from region 1-124.

Product Specifications

Product Name Alternative

SPBc2 prophage-derived uncharacterized protein yoqO

UniProt

O31923

Expression Region

1-124

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKTIGITGFFLSIVVQSFSANDSLSHKIATGLLFVSIAIYNFDHAKDYSKASLVVICLT FFVLALGIHKLLSFSSDLFDNVNINFGVIFILQITLIIGSVAIAISIMKFICDRLKKKPN GKEC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAGE4 shRNA Plasmid (h)
sc-91411-SH 20 µg

BAGE4 shRNA Plasmid (h)

Sign In for Pricing
View Details
ELISA Kit for Adrenomedullin (ADM)
TRV-0005989-01 24 Tests

ELISA Kit for Adrenomedullin (ADM)

Sign In for Pricing
View Details
ELISA Kit for Adrenomedullin (ADM)
TRV-0005989-02 48 Tests

ELISA Kit for Adrenomedullin (ADM)

Sign In for Pricing
View Details
ELISA Kit for Adrenomedullin (ADM)
TRV-0005989-03 96 Tests

ELISA Kit for Adrenomedullin (ADM)

Sign In for Pricing
View Details
ELISA Kit for Adrenomedullin (ADM)
TRV-0005989-04 5x 96 Tests

ELISA Kit for Adrenomedullin (ADM)

Sign In for Pricing
View Details
ELISA Kit for Adrenomedullin (ADM)
TRV-0005989-05 10x 96 Tests

ELISA Kit for Adrenomedullin (ADM)

Sign In for Pricing
View Details