Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Brain protein I3 (BRI3)

This Recombinant Bovine Brain protein I3 (BRI3) spans the amino acid sequence from region 1-124.

Product Specifications

Product Name Alternative

Brain protein I3

UniProt

Q32L83

Expression Region

1-124

Origin

Bos taurus (Bovine)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDHKPLLQERPPAYNLEAGQGEFACAPHGYGAIAAAPPPPYPYLVTGIPTHHPRVYNIHS RNVTRYPANSIVVVGGCPVCRVGVLEDSFTFLGIFLAIVLFPFGFICCFALRKRRCPNCG ANFT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin-CF®680R
#80037 1x 1 mg

Biotin-CF®680R

Sign In for Pricing
View Details
GULP1 Polyclonal Antibody
E-AB-17787-01 20 µL

GULP1 Polyclonal Antibody

Sign In for Pricing
View Details
GULP1 Polyclonal Antibody
E-AB-17787-02 60 µL

GULP1 Polyclonal Antibody

Sign In for Pricing
View Details
GULP1 Polyclonal Antibody
E-AB-17787-03 120 µL

GULP1 Polyclonal Antibody

Sign In for Pricing
View Details
GULP1 Polyclonal Antibody
E-AB-17787-04 200 µL

GULP1 Polyclonal Antibody

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human HLA-DQ Antibody[1a3]
AN00421M-01 20 Tests

Elab Fluor® 647 Anti-Human HLA-DQ Antibody[1a3]

Sign In for Pricing
View Details