Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Brain protein I3 (BRI3)

This Recombinant Bovine Brain protein I3 (BRI3) spans the amino acid sequence from region 1-124.

Product Specifications

Product Name Alternative

Brain protein I3

UniProt

Q32L83

Expression Region

1-124

Origin

Bos taurus (Bovine)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDHKPLLQERPPAYNLEAGQGEFACAPHGYGAIAAAPPPPYPYLVTGIPTHHPRVYNIHS RNVTRYPANSIVVVGGCPVCRVGVLEDSFTFLGIFLAIVLFPFGFICCFALRKRRCPNCG ANFT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 7 (KRT7/903), 0.2mg/mL
BNUB0903-500 1x 500 µL

Cytokeratin 7 (KRT7/903), 0.2mg/mL

Sign In for Pricing
View Details
Cyclin D1 Rabbit Polyclonal Antibody
0407-27 100 µL

Cyclin D1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Rat IL1R1/CD121a Protein (His & Fc Tag)
PKSR030395 100 µg

Recombinant Rat IL1R1/CD121a Protein (His & Fc Tag)

Sign In for Pricing
View Details
P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/1423R), Biotin conjugate, 0.1mg/mL
BNCB1423-500 1x 500 µL

P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/1423R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Slc39a6 Mouse Gene Knockout Kit (CRISPR)
KN516110 1 Kit

Slc39a6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SH3GLB2 (NM_020145) Human Over-expression Lysate
LY402767 100 µg

SH3GLB2 (NM_020145) Human Over-expression Lysate

Sign In for Pricing
View Details