Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Kinocilin (Kncn)

This Recombinant Mouse Kinocilin (Kncn) spans the amino acid sequence from region 1-124.

Product Specifications

Product Name Alternative

Kinocilin

UniProt

Q307W7

Expression Region

1-124

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDIPISTRDFRCLQLACVALGLVAGSIIIGVSVSKAAAAVGGIFLGAAGLGLLIFAYPFL KARFNLDHILPAIGNLRIHPNSGPDHGEGRSSNNSNKEGARSGLSTVTRTLEKLKPGGRG TEEG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD32 (FCGR2C) Human shRNA Lentiviral Particle (Locus ID 9103)
TL307934V 500 µL Each

CD32 (FCGR2C) Human shRNA Lentiviral Particle (Locus ID 9103)

Sign In for Pricing
View Details
4- (Thien-2-yl) benzoic acid
sc-261502A 2 g

4- (Thien-2-yl) benzoic acid

Sign In for Pricing
View Details
OR6C1 Rabbit Polyclonal Antibody (FITC)
orb2086893 100 µL

OR6C1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
PHGDH Rabbit Polyclonal Antibody
TA334410 100 µL

PHGDH Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Chlamydia trachomatis (MOMP) -HRP
GWB-A723FB 1 mL

Chlamydia trachomatis (MOMP) -HRP

Sign In for Pricing
View Details
MORF4L1P3 Recombinant Protein (Human)
RP075522 100 µg

MORF4L1P3 Recombinant Protein (Human)

Sign In for Pricing
View Details