Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Kinocilin (Kncn)

This Recombinant Mouse Kinocilin (Kncn) spans the amino acid sequence from region 1-124.

Product Specifications

Product Name Alternative

Kinocilin

UniProt

Q307W7

Expression Region

1-124

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDIPISTRDFRCLQLACVALGLVAGSIIIGVSVSKAAAAVGGIFLGAAGLGLLIFAYPFL KARFNLDHILPAIGNLRIHPNSGPDHGEGRSSNNSNKEGARSGLSTVTRTLEKLKPGGRG TEEG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Heat Shock Protein 90kDa Beta 1,HSP90b1 ELISA KIT
JOT-EK3012Hu-01 96 Well

Human Heat Shock Protein 90kDa Beta 1,HSP90b1 ELISA KIT

Sign In for Pricing
View Details
Human Heat Shock Protein 90kDa Beta 1,HSP90b1 ELISA KIT
JOT-EK3012Hu-02 48 Well

Human Heat Shock Protein 90kDa Beta 1,HSP90b1 ELISA KIT

Sign In for Pricing
View Details
mmu-miR-9769-5p miRNA Mimic
MBS8302540-01 5 nmol

mmu-miR-9769-5p miRNA Mimic

Sign In for Pricing
View Details
mmu-miR-9769-5p miRNA Mimic
MBS8302540-02 10 nmol

mmu-miR-9769-5p miRNA Mimic

Sign In for Pricing
View Details
mmu-miR-9769-5p miRNA Mimic
MBS8302540-03 5x 10 nmol

mmu-miR-9769-5p miRNA Mimic

Sign In for Pricing
View Details
SPINK6 Rabbit Polyclonal Antibody (AP)
orb951161 100 µL

SPINK6 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details