Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Kinocilin (Kncn)

This Recombinant Mouse Kinocilin (Kncn) spans the amino acid sequence from region 1-124.

Product Specifications

Product Name Alternative

Kinocilin

UniProt

Q307W7

Expression Region

1-124

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDIPISTRDFRCLQLACVALGLVAGSIIIGVSVSKAAAAVGGIFLGAAGLGLLIFAYPFL KARFNLDHILPAIGNLRIHPNSGPDHGEGRSSNNSNKEGARSGLSTVTRTLEKLKPGGRG TEEG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit For Endothelial protein C receptor
E0022r 96 Tests

ELISA Kit For Endothelial protein C receptor

Sign In for Pricing
View Details
LGALS2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1209807 1.0 µg DNA

LGALS2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Recombinant Human Regenerating Islet-Derived 1 Beta
32-4632-10 10 µg

Recombinant Human Regenerating Islet-Derived 1 Beta

Sign In for Pricing
View Details
Monkey beta2-microglobulin, BMG/beta2-MG ELISA Kit
SL0012Mk-01 48 Tests

Monkey beta2-microglobulin, BMG/beta2-MG ELISA Kit

Sign In for Pricing
View Details
Monkey beta2-microglobulin, BMG/beta2-MG ELISA Kit
SL0012Mk-02 96 Tests

Monkey beta2-microglobulin, BMG/beta2-MG ELISA Kit

Sign In for Pricing
View Details
Recombinant Human MAP kinase-activated protein kinase 3
BP2081-500ug 500 µg

Recombinant Human MAP kinase-activated protein kinase 3

Sign In for Pricing
View Details