Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo pygmaeus NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial (NDUFB11)

This Recombinant Pongo pygmaeus NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial (NDUFB11) spans the amino acid sequence from region 30-153.

Product Specifications

Product Name Alternative

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial, Complex I-ESSS, CI-ESSS, NADH-ubiquinone oxidoreductase ESSS subunit

UniProt

Q0MQJ3

Expression Region

30-153

Origin

Pongo pygmaeus (Bornean orangutan)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ESSFSRTVVAPSAVARKRLPEPTTQWQEDLDPEDENLYEKNPDSHGYDKDPVLDVWNMRL VFFFGVSIILVLGSTFVAYLPDYRMKEWSRREAERLVKYREANGLPIMESNCFDPSKIQL PEDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GENLISA™ Human Inter Alpha - Globulin Inhibitor H4 (ITIH4) ELISA
KBH2758 1x 96 Well

GENLISA™ Human Inter Alpha - Globulin Inhibitor H4 (ITIH4) ELISA

Sign In for Pricing
View Details
SARS-CoV-2 Spike Recombinant HEK293 Cells Monomeric C-Terminus HIS Labeled Lyophilized
ICOV2ST4HEKHIS1000UG 1 Each

SARS-CoV-2 Spike Recombinant HEK293 Cells Monomeric C-Terminus HIS Labeled Lyophilized

Sign In for Pricing
View Details
Human OR2H1 Knockout A549 cell line
GTR15408427 1 Vial

Human OR2H1 Knockout A549 cell line

Sign In for Pricing
View Details
Mouse Monoclonal Hydroxyacid Oxidase-1/HAO-1 Antibody (OTI5C3) [Alexa Fluor 750]
NBP2-71954AF750 0.1 mL

Mouse Monoclonal Hydroxyacid Oxidase-1/HAO-1 Antibody (OTI5C3) [Alexa Fluor 750]

Sign In for Pricing
View Details
4-Bromo-1- (tetrahydro-2H-pyran-2-yl) -1H-pyrazole
sc-310982A 5 g

4-Bromo-1- (tetrahydro-2H-pyran-2-yl) -1H-pyrazole

Sign In for Pricing
View Details
Myh10 sgRNA CRISPR Lentivector (Rat) (Target 1)
K7525302 1.0 µg DNA

Myh10 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details