Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gorilla gorilla gorilla NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial (NDUFB11)

This Recombinant Gorilla gorilla gorilla NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial (NDUFB11) spans the amino acid sequence from region 30-153.

Product Specifications

Product Name Alternative

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial, Complex I-ESSS, CI-ESSS, NADH-ubiquinone oxidoreductase ESSS subunit

UniProt

Q0MQJ4

Expression Region

30-153

Origin

Gorilla gorilla gorilla (Lowland gorilla)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ESSFSRTVVAPSAVAGKRPPEPTTQWQEDPEPEDENLYEKNPDSHGYDKDPVLDVWNMRL VFFFGVSIILVLGSTFVAYLPDYRMKEWSRREAERLVKYREANGLPIMESNCFDPSKIEL PEDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-ILKAP antibody
SL16605R-01 50 µL

Rabbit Anti-ILKAP antibody

Sign In for Pricing
View Details
Rabbit Anti-ILKAP antibody
SL16605R-02 100 µL

Rabbit Anti-ILKAP antibody

Sign In for Pricing
View Details
ST6GALNAC2, Mouse (HEK293, His)
HY-P71333 1 Each

ST6GALNAC2, Mouse (HEK293, His)

Sign In for Pricing
View Details
NDUFV2 Polyclonal Antibody
E44H05433 100 µL

NDUFV2 Polyclonal Antibody

Sign In for Pricing
View Details
ETV7 Peptide - N-terminal region (AAP37765)
AAP37765-100UG 100 µg

ETV7 Peptide - N-terminal region (AAP37765)

Sign In for Pricing
View Details
Anti-DDX5,p68 antibody
PAab02312 100 µg

Anti-DDX5,p68 antibody

Sign In for Pricing
View Details