Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1580 (MJ1580)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1580 (MJ1580) spans the amino acid sequence from region 1-124.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1580

UniProt

Q58975

Expression Region

1-124

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLIKILEEKLMELIQIVGVIFALFALSRVVLQLKRRSISFNEGLFWIFVWGFVVIFLVFP EFFGYVAEVLGVGRGVDALIYISIVVLFYLIYRLYAKINNLERQITHIVREIAIRDRYEP KKRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM107B (NM_001282699) Human Tagged ORF Clone
RG235908 10 µg

FAM107B (NM_001282699) Human Tagged ORF Clone

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8/803), Biotin conjugate, 0.1mg/mL
BNCB0803-500 1x 500 µL

Cytokeratin 8 (KRT8/803), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
N-Nitroso Tofenacin (>99%)
TRC-O695403-50MG 50 mg

N-Nitroso Tofenacin (>99%)

Sign In for Pricing
View Details
ZNF697 Human Gene Knockout Kit (CRISPR)
KN415507 1 Kit

ZNF697 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ABH2 (ALKBH2) (NM_001145374) Human Recombinant Protein
TP326507M 100 µg

ABH2 (ALKBH2) (NM_001145374) Human Recombinant Protein

Sign In for Pricing
View Details
LRRN3 Mouse Monoclonal Antibody [A4-6-3]
M1012-8 100 µL

LRRN3 Mouse Monoclonal Antibody [A4-6-3]

Sign In for Pricing
View Details