Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1580 (MJ1580)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1580 (MJ1580) spans the amino acid sequence from region 1-124.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1580

UniProt

Q58975

Expression Region

1-124

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLIKILEEKLMELIQIVGVIFALFALSRVVLQLKRRSISFNEGLFWIFVWGFVVIFLVFP EFFGYVAEVLGVGRGVDALIYISIVVLFYLIYRLYAKINNLERQITHIVREIAIRDRYEP KKRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kallikrein 8 (KLK8) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A10]
TA506131BM 100 µL

Kallikrein 8 (KLK8) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A10]

Sign In for Pricing
View Details
rac-Synephrine
TRC-S920000-5G 5 g

rac-Synephrine

Sign In for Pricing
View Details
Elab Fluor® Violet 540 Rat IgG2a, κ Isotype Control[2A3]
E-AB-F09833T3-01 25 µg

Elab Fluor® Violet 540 Rat IgG2a, κ Isotype Control[2A3]

Sign In for Pricing
View Details
Elab Fluor® Violet 540 Rat IgG2a, κ Isotype Control[2A3]
E-AB-F09833T3-02 100 µg

Elab Fluor® Violet 540 Rat IgG2a, κ Isotype Control[2A3]

Sign In for Pricing
View Details
Recombinant Human TINAGL1 Protein (His Tag)
PKSH033159-01 10 µg

Recombinant Human TINAGL1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human TINAGL1 Protein (His Tag)
PKSH033159-02 50 µg

Recombinant Human TINAGL1 Protein (His Tag)

Sign In for Pricing
View Details