Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1580 (MJ1580)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1580 (MJ1580) spans the amino acid sequence from region 1-124.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1580

UniProt

Q58975

Expression Region

1-124

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLIKILEEKLMELIQIVGVIFALFALSRVVLQLKRRSISFNEGLFWIFVWGFVVIFLVFP EFFGYVAEVLGVGRGVDALIYISIVVLFYLIYRLYAKINNLERQITHIVREIAIRDRYEP KKRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, pan (Epithelial Marker) (KRTH/1576R + KRTL/1577R), 0.2mg/mL
BNUB1600-100 1x 100 µL

Cytokeratin, pan (Epithelial Marker) (KRTH/1576R + KRTL/1577R), 0.2mg/mL

Sign In for Pricing
View Details
MRPL24 Mouse Monoclonal Antibody [Clone ID: OTI1A10]
CF813135 100 µg

MRPL24 Mouse Monoclonal Antibody [Clone ID: OTI1A10]

Sign In for Pricing
View Details
FITC Conjugated Cicer arietinum Lectin (Chick Pea) -CPA-
F-6601-1 1 mg

FITC Conjugated Cicer arietinum Lectin (Chick Pea) -CPA-

Sign In for Pricing
View Details
N-Boc-γ-aminobutyric Acid
TRC-N656140-1G 1 g

N-Boc-γ-aminobutyric Acid

Sign In for Pricing
View Details
Mouse Pira2 activation kit by CRISPRa
GA203228 1 Kit

Mouse Pira2 activation kit by CRISPRa

Sign In for Pricing
View Details
STAT4 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI 1H3]
TA502969BM 100 µL

STAT4 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI 1H3]

Sign In for Pricing
View Details