Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C11orf92 (C11orf92)

This Recombinant Human Uncharacterized protein C11orf92 (C11orf92) spans the amino acid sequence from region 1-124.

Product Specifications

Product Name Alternative

Uncharacterized protein C11orf92

UniProt

Q6ZS62

Expression Region

1-124

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESCSVAQAGVLTSPFMWRWTGMAGALSALDNTIEDDADDQLPCGEGRPGWVRGELLGSQ GVCKDSKDLFVPTSSSLYGCFCVGLVSGMAISVLLLASDFRKLDFSRPEPCFEKEASLWF VAQH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IMPDH1P11 3'UTR Luciferase Stable Cell Line
TU011143 1.0 mL

IMPDH1P11 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
CLH1 Polyclonal Antibody
E44H10406 100 µL

CLH1 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human WDR33 Protein - (Dry Ice)
H00055339-P01-2ug 2 µg

Recombinant Human WDR33 Protein - (Dry Ice)

Sign In for Pricing
View Details
Human LAG3 Protein, hFc Tag
E33P100513 10 µg

Human LAG3 Protein, hFc Tag

Sign In for Pricing
View Details
Cytidine Impurity 11
RM-C205911-01 10 mg

Cytidine Impurity 11

Sign In for Pricing
View Details
Cytidine Impurity 11
RM-C205911-02 25 mg

Cytidine Impurity 11

Sign In for Pricing
View Details