Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C11orf92 (C11orf92)

This Recombinant Human Uncharacterized protein C11orf92 (C11orf92) spans the amino acid sequence from region 1-124.

Product Specifications

Product Name Alternative

Uncharacterized protein C11orf92

UniProt

Q6ZS62

Expression Region

1-124

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESCSVAQAGVLTSPFMWRWTGMAGALSALDNTIEDDADDQLPCGEGRPGWVRGELLGSQ GVCKDSKDLFVPTSSSLYGCFCVGLVSGMAISVLLLASDFRKLDFSRPEPCFEKEASLWF VAQH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

a (nonagouti) Adenovirus (Mouse)
10914054 1.0 mL

a (nonagouti) Adenovirus (Mouse)

Sign In for Pricing
View Details
Rabbit Polyclonal PPIL2 Antibody [FITC]
NBP3-00291F 0.1 mL

Rabbit Polyclonal PPIL2 Antibody [FITC]

Sign In for Pricing
View Details
Slco1a5 Rat siRNA Oligo Duplex (Locus ID 80900)
SR500524 1 Kit

Slco1a5 Rat siRNA Oligo Duplex (Locus ID 80900)

Sign In for Pricing
View Details
Lentiviral human CATSPER2 shRNA (UAS) - Lentiviral human CATSPER2 shRNA (UAS, iRFP) plasmid
GTR15324667 1 Vial

Lentiviral human CATSPER2 shRNA (UAS) - Lentiviral human CATSPER2 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
PSPH antibody - middle region
MBS3212866-01 0.1 mL

PSPH antibody - middle region

Sign In for Pricing
View Details
PSPH antibody - middle region
MBS3212866-02 5x 0.1 mL

PSPH antibody - middle region

Sign In for Pricing
View Details