Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactobacillus johnsonii Large-conductance mechanosensitive channel (mscL)

This Recombinant Lactobacillus johnsonii Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-124.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

Q74HV9

Expression Region

1-124

Origin

Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVKEFKEFISRGNMMDLAVGVIIGAAFTAIVNSLVKDLINPLIGLFIGKIDLSNLKFTIG EATFKYGSFLNAVINFLIIALVVFFLIKLVNKITPKKEVEEDPAPTNEEIYLRQIRDLLQ EKNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11c (HC1/1), CF680R conjugate, 0.1mg/mL
BNC810152-500 1x 500 µL

CD11c (HC1/1), CF680R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF568 conjugate, 0.1mg/mL
BNC680189-500 1x 500 µL

CD74 (BU45), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF405S conjugate, 0.1mg/mL
BNC040032-500 1x 500 µL

MUC2 (CCP58), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF647 conjugate, 0.1mg/mL
BNC470851-100 1x 100 µL

HSP60 (LK1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (EGP40/826), CF640R conjugate, 0.1mg/mL
BNC400826-100 1x 100 µL

Ep-CAM / CD326 (EGP40/826), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2602), CF647 conjugate, 0.1mg/mL
BNC472602-500 1x 500 µL

Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2602), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details