Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial (NDUFB11)

This Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial (NDUFB11) spans the amino acid sequence from region 30-153.

Product Specifications

Product Name Alternative

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial, Complex I-ESSS, CI-ESSS, NADH-ubiquinone oxidoreductase ESSS subunit, Neuronal protein 17.3

UniProt

Q9NX14

Expression Region

30-153

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ESSFSRTVVAPSAVAGKRPPEPTTPWQEDPEPEDENLYEKNPDSHGYDKDPVLDVWNMRL VFFFGVSIILVLGSTFVAYLPDYRMKEWSRREAERLVKYREANGLPIMESNCFDPSKIQL PEDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC2 (CCP58), CF568 conjugate, 0.1mg/mL
BNC680032-100 1x 100 µL

MUC2 (CCP58), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF568 conjugate, 0.1mg/mL
BNC681052-100 1x 100 µL

CD3e (B-B12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF647 conjugate, 0.1mg/mL
BNC470676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Filaggrin (Keratinocyte Differentiation Marker) (FLG/1561), CF640R conjugate, 0.1mg/mL
BNC401561-100 1x 100 µL

Filaggrin (Keratinocyte Differentiation Marker) (FLG/1561), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8b, Mouse (H35-17.2), CF640R conjugate, 0.1mg/mL
BNC402003-500 1x 500 µL

CD8b, Mouse (H35-17.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Glycophorin A / CD235a (Erythrocyte Marker) (rGYPA/280), CF488A conjugate, 0.1mg/mL
BNC881868-100 1x 100 µL

Glycophorin A / CD235a (Erythrocyte Marker) (rGYPA/280), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details