Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Kinocilin (KNCN)

This Recombinant Human Kinocilin (KNCN) spans the amino acid sequence from region 1-124.

Product Specifications

Product Name Alternative

Kinocilin

UniProt

A6PVL3

Expression Region

1-124

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDIPISSRDFRGLQLACVALGLVAGSIIIGISVSKAAAAMGGVFIGAAVLGLLILAYPFL KARFNLDHILPTIGSLRIHPHPGADHGEGRSSTNGNKEGARSSLSTVSRTLEKLKPGTRG AEEC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TUBA3FP Protein Vector (Human) (pPM-C-HA)
48799021 500 ng

TUBA3FP Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Ethylene glycol diformate
E09117-01 10 g

Ethylene glycol diformate

Sign In for Pricing
View Details
Ethylene glycol diformate
E09117-02 50 g

Ethylene glycol diformate

Sign In for Pricing
View Details
IPO7 Antibody
orb2677568-01 50 µL

IPO7 Antibody

Sign In for Pricing
View Details
IPO7 Antibody
orb2677568-02 100 µL

IPO7 Antibody

Sign In for Pricing
View Details
IPO7 Antibody
orb2677568-03 200 µL

IPO7 Antibody

Sign In for Pricing
View Details