Recombinant Ochrobactrum anthropi Lectin-like protein BA14k (Oant_3884)
This Recombinant Ochrobactrum anthropi Lectin-like protein BA14k (Oant_3884) spans the amino acid sequence from region 27-151.
Product Specifications
Product Name Alternative
Lectin-like protein BA14k
UniProt
A6X5T5
Expression Region
27-151
Origin
Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
APLNLERPVINHNVEQVRDHRRPPRHYNGHRPHRPGYWNGHRGYRHYRHGYRRYNDGWWY PLAAFGAGAIIGGAVSQPRPVYRAPRMSNAHVQWCYNRYKSYRSSDNTFQPYNGPRRQCY SPYSR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880050-100 1x 100 µL
IgA Secretory Component (SC05), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC051429-100 1x 100 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405M conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880860-100 1x 100 µL
Human Lambda Light Chain (Lamb14), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details