Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2191 (AF_2191)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2191 (AF_2191) spans the amino acid sequence from region 1-125.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_2191

UniProt

O28092

Expression Region

1-125

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLYGRIFFNSGVQLLSMADKKFSLIALVSFTALAIIVLYHNISPYLTPSDLIAQGKAENV QVVGKIVSVNGNTFQLSDGKNTITAVYNGTVQRYDAEVVVVGNWDGKVLHATKVLQKCHT EYKGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gtf2e2 ORF Vector (Mouse) (pORF)
ORF046782 1.0 µg DNA

Gtf2e2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Genorise® recombinant Mouse YAP1 protein
GR124118 5 µg

Genorise® recombinant Mouse YAP1 protein

Sign In for Pricing
View Details
9-Aminoacridine hydrochloride monohydrate
GP6992-25g 25 g

9-Aminoacridine hydrochloride monohydrate

Sign In for Pricing
View Details
Phospho-c-Abl (Tyr276) Polyclonal Antibody, PE Conjugated
bs-4086R-PE 100 µL

Phospho-c-Abl (Tyr276) Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
Recombinant Cynomolgus Programmed cell death ligand 2/PD-L2 (C-Fc)
32-9352-500 500 µg

Recombinant Cynomolgus Programmed cell death ligand 2/PD-L2 (C-Fc)

Sign In for Pricing
View Details
Recombinant Human Putative uncharacterized protein C21orf37 (C21orf37)
MBS1131465-01 0.02 mg (E-Coli)

Recombinant Human Putative uncharacterized protein C21orf37 (C21orf37)

Sign In for Pricing
View Details