Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2191 (AF_2191)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2191 (AF_2191) spans the amino acid sequence from region 1-125.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_2191

UniProt

O28092

Expression Region

1-125

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLYGRIFFNSGVQLLSMADKKFSLIALVSFTALAIIVLYHNISPYLTPSDLIAQGKAENV QVVGKIVSVNGNTFQLSDGKNTITAVYNGTVQRYDAEVVVVGNWDGKVLHATKVLQKCHT EYKGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Coiled Coil Domain Containing 80 (CCDC80) ELISA Kit
abx505468 96 Tests

Rat Coiled Coil Domain Containing 80 (CCDC80) ELISA Kit

Sign In for Pricing
View Details
ASFV I9R Antibody
E55A11137 100 µL

ASFV I9R Antibody

Sign In for Pricing
View Details
Olfr943 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4290007 1.0 µg DNA

Olfr943 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Iba1/AIF-1 (E4O4W) & CO-0100-647 SignalStar™ Oligo-Antibody Pair
CST 84747S 1 Kit

Iba1/AIF-1 (E4O4W) & CO-0100-647 SignalStar™ Oligo-Antibody Pair

Sign In for Pricing
View Details
F9 ORF Vector (Rat) (pORF)
19630016 1.0 µg DNA

F9 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
SLC9A3R2 3'UTR Luciferase Stable Cell Line
TU023366 1.0 mL

SLC9A3R2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details