Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2191 (AF_2191)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2191 (AF_2191) spans the amino acid sequence from region 1-125.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_2191

UniProt

O28092

Expression Region

1-125

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLYGRIFFNSGVQLLSMADKKFSLIALVSFTALAIIVLYHNISPYLTPSDLIAQGKAENV QVVGKIVSVNGNTFQLSDGKNTITAVYNGTVQRYDAEVVVVGNWDGKVLHATKVLQKCHT EYKGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAMK2D (NM_172128) Human Untagged Clone
SC126554 10 µg

CAMK2D (NM_172128) Human Untagged Clone

Sign In for Pricing
View Details
Anti-Adipophilin / Perilipin-2 (Marker of Lipid Accumulation) Monoclonal Antibody (Clone: ADFP/1493)
36-2098-20 20 µg

Anti-Adipophilin / Perilipin-2 (Marker of Lipid Accumulation) Monoclonal Antibody (Clone: ADFP/1493)

Sign In for Pricing
View Details
Mouse Rbpms2 qPCR Primer Pair
QM40554S 200 Tests

Mouse Rbpms2 qPCR Primer Pair

Sign In for Pricing
View Details
ZNF165 (NM_003447) Human Tagged ORF Clone Lentiviral Particle
RC205600L1V 200 µL

ZNF165 (NM_003447) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PSA antibody
10-7948 1 mg

PSA antibody

Sign In for Pricing
View Details
RPS23 discontinued
531638-01 20 µL

RPS23 discontinued

Sign In for Pricing
View Details