Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Brain protein I3 (Bri3)

This Recombinant Rat Brain protein I3 (Bri3) spans the amino acid sequence from region 1-125.

Product Specifications

Product Name Alternative

Brain protein I3

UniProt

Q5PPK1

Expression Region

1-125

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDHKPLLQERPPAYNLEAGQGDYACGPHGYGAIPTAPPPPPYPYLVTGIPTSHPRVYNIH SRAVTRYPANSIVVVGGCPVCRVGVLEYCFTCLGIFLAIVLFPFGFLCCFALRKRRCPNC GAVFT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® 488 Anti-Human CD5 Antibody[5D7]
E-AB-F1371L-01 20 Tests

Elab Fluor® 488 Anti-Human CD5 Antibody[5D7]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD5 Antibody[5D7]
E-AB-F1371L-02 100 Tests

Elab Fluor® 488 Anti-Human CD5 Antibody[5D7]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD5 Antibody[5D7]
E-AB-F1371L-03 2x 100 Tests

Elab Fluor® 488 Anti-Human CD5 Antibody[5D7]

Sign In for Pricing
View Details
Water RNA/DNA Purification Kit
26480 50 Preparations

Water RNA/DNA Purification Kit

Sign In for Pricing
View Details
BRCA1 (Breast Marker) (BRCA1/1398), 0.2mg/mL
BNUB1398-100 1x 100 µL

BRCA1 (Breast Marker) (BRCA1/1398), 0.2mg/mL

Sign In for Pricing
View Details
BRCC36 (BRCC3) Mouse Monoclonal Antibody [Clone ID: AT3B1]
AM09089PU-S 50 µL

BRCC36 (BRCC3) Mouse Monoclonal Antibody [Clone ID: AT3B1]

Sign In for Pricing
View Details