Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Brain protein I3 (Bri3)

This Recombinant Rat Brain protein I3 (Bri3) spans the amino acid sequence from region 1-125.

Product Specifications

Product Name Alternative

Brain protein I3

UniProt

Q5PPK1

Expression Region

1-125

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDHKPLLQERPPAYNLEAGQGDYACGPHGYGAIPTAPPPPPYPYLVTGIPTSHPRVYNIH SRAVTRYPANSIVVVGGCPVCRVGVLEYCFTCLGIFLAIVLFPFGFLCCFALRKRRCPNC GAVFT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FAM71F2 activation kit by CRISPRa
GA117631 1 Kit

Human FAM71F2 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Blocks, Liver
CB518561 1 Block

Frozen Tissue Blocks, Liver

Sign In for Pricing
View Details
Archaemetzincin 2 (AMZ2) (NM_001033571) Human Over-expression Lysate
LY422397 100 µg

Archaemetzincin 2 (AMZ2) (NM_001033571) Human Over-expression Lysate

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (HMPV), 0.2mg/mL
BNUB0954-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (HMPV), 0.2mg/mL

Sign In for Pricing
View Details
Guar Gum
TRC-G844710-5G 5 g

Guar Gum

Sign In for Pricing
View Details
4-Amino-2-chlorobenzoic Acid
TRC-A603270-25G 25 g

4-Amino-2-chlorobenzoic Acid

Sign In for Pricing
View Details