Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Brain protein I3 (Bri3)

This Recombinant Rat Brain protein I3 (Bri3) spans the amino acid sequence from region 1-125.

Product Specifications

Product Name Alternative

Brain protein I3

UniProt

Q5PPK1

Expression Region

1-125

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDHKPLLQERPPAYNLEAGQGDYACGPHGYGAIPTAPPPPPYPYLVTGIPTSHPRVYNIH SRAVTRYPANSIVVVGGCPVCRVGVLEYCFTCLGIFLAIVLFPFGFLCCFALRKRRCPNC GAVFT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CLEC1 (CLEC1A) activation kit by CRISPRa
GA109690 1 Kit

Human CLEC1 (CLEC1A) activation kit by CRISPRa

Sign In for Pricing
View Details
Tmem121 Mouse Gene Knockout Kit (CRISPR)
KN517707 1 Kit

Tmem121 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FITC Anti-Mouse CD335/NKp46 Antibody[29A1.4]
E-AB-F1182UC-01 25 µg

FITC Anti-Mouse CD335/NKp46 Antibody[29A1.4]

Sign In for Pricing
View Details
FITC Anti-Mouse CD335/NKp46 Antibody[29A1.4]
E-AB-F1182UC-02 100 µg

FITC Anti-Mouse CD335/NKp46 Antibody[29A1.4]

Sign In for Pricing
View Details
PTH / Parathyroid Hormone (N-Terminal) (3H9), CF568 conjugate, 0.1mg/mL
BNC680242-100 1x 100 µL

PTH / Parathyroid Hormone (N-Terminal) (3H9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CZIB Antibody
KC-32074-01 50 μL

CZIB Antibody

Sign In for Pricing
View Details