Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 14E (TMEM14E)

This Recombinant Human Transmembrane protein 14E (TMEM14E) spans the amino acid sequence from region 1-125.

Product Specifications

Product Name Alternative

Transmembrane protein 14E

UniProt

Q6UXP3

Expression Region

1-125

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQMDPGPQVPLYWLGFVYAALAALGGISGYAKVGSVQSPSAGFFFSELAGLDASQPSRNP KEHLSSPVYIWDLARYYANKILTLWNIYACGFSCRCLLIVSKLGSMYGEQILSVVAMSQL GLMKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 (MaxLight 550)
C2383-02D-ML550 100 µL

CD31 (MaxLight 550)

Sign In for Pricing
View Details
Eukaryotic Pulmonary Surfactant Associated Protein A1 (SFTPA1), Recombinant, Human, His-Tag
057475-01 10 µg

Eukaryotic Pulmonary Surfactant Associated Protein A1 (SFTPA1), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
Eukaryotic Pulmonary Surfactant Associated Protein A1 (SFTPA1), Recombinant, Human, His-Tag
057475-02 50 µg

Eukaryotic Pulmonary Surfactant Associated Protein A1 (SFTPA1), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
Eukaryotic Pulmonary Surfactant Associated Protein A1 (SFTPA1), Recombinant, Human, His-Tag
057475-03 100 µg

Eukaryotic Pulmonary Surfactant Associated Protein A1 (SFTPA1), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
Eukaryotic Pulmonary Surfactant Associated Protein A1 (SFTPA1), Recombinant, Human, His-Tag
057475-04 200 µg

Eukaryotic Pulmonary Surfactant Associated Protein A1 (SFTPA1), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
Anti-CARD 6 antibody
STJ92002 200 µl

Anti-CARD 6 antibody

Sign In for Pricing
View Details