Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 14E (TMEM14E)

This Recombinant Human Transmembrane protein 14E (TMEM14E) spans the amino acid sequence from region 1-125.

Product Specifications

Product Name Alternative

Transmembrane protein 14E

UniProt

Q6UXP3

Expression Region

1-125

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQMDPGPQVPLYWLGFVYAALAALGGISGYAKVGSVQSPSAGFFFSELAGLDASQPSRNP KEHLSSPVYIWDLARYYANKILTLWNIYACGFSCRCLLIVSKLGSMYGEQILSVVAMSQL GLMKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ndufs2 (NM_153064) Mouse Tagged ORF Clone Lentiviral Particle
MR207399L4V 200 µL

Ndufs2 (NM_153064) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
TAF6L Recombinant Protein Antigen
NBP2-39083PEP 0.1 mL

TAF6L Recombinant Protein Antigen

Sign In for Pricing
View Details
U2af2 Rat Pre-designed siRNA Set A
HY-RS29404 1 Set

U2af2 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
Lentiviral human GABRP sgRNA gene knockout kit - Lentiviral human GABRP sgRNA gene knockout kit (25)
GTR15387090 1 Vial

Lentiviral human GABRP sgRNA gene knockout kit - Lentiviral human GABRP sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
SLC46A3 Recombinant Protein (Mouse)
RP173258 100 µg

SLC46A3 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Rabbit Anti-Human PAK1 pAb
PA12996-01 50 μL

Rabbit Anti-Human PAK1 pAb

Sign In for Pricing
View Details