Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Guinea pig Brain protein I3 (I3)

This Recombinant Guinea pig Brain protein I3 (I3) spans the amino acid sequence from region 1-125.

Product Specifications

Product Name Alternative

Brain protein I3

UniProt

Q99N46

Expression Region

1-125

Origin

Cavia porcellus (Guinea pig)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDHKPLLQERPPAYNLEAGQGDYACGAPGYGAIPSAPPPPPYPYLVTGIPTPHPRVYSIH SRTVTRYPANSIVVVGGCPVCRVGVLEDCFTFLGIFLAIILFPFGFICCFALRKRRCPNC GATFT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bilastine 200mg
A12661-200 200 mg

Bilastine 200mg

Sign In for Pricing
View Details
TRIM68 sgRNA CRISPR Lentivector (Human) (Target 3)
K2469004 1.0 µg DNA

TRIM68 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
SERPINB6 Polyclonal Antibody
MBS9129970-01 0.02 mL

SERPINB6 Polyclonal Antibody

Sign In for Pricing
View Details
SERPINB6 Polyclonal Antibody
MBS9129970-02 0.1 mL

SERPINB6 Polyclonal Antibody

Sign In for Pricing
View Details
SERPINB6 Polyclonal Antibody
MBS9129970-03 5x 0.1 mL

SERPINB6 Polyclonal Antibody

Sign In for Pricing
View Details
KM10103
orb1700232-01 25 mg

KM10103

Sign In for Pricing
View Details