Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactobacillus salivarius Large-conductance mechanosensitive channel (mscL)

This Recombinant Lactobacillus salivarius Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-125.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

Q1WVR1

Expression Region

1-125

Origin

Lactobacillus salivarius (strain UCC118)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLKEFKEFISRGNVMDLAVGVIIGGAFTAIVNSLVKYIINPFLGLFVGAIDFSDLVFKIG NATFRVGSFLNAVINFLIIAFVVFLMVKGINKVLRQDKKEEAPAPKDPQLEVLEEIRDSL KKLDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGE A1 (MA454), CF488A conjugate, 0.1mg/mL
BNC880008-500 1x 500 µL

MAGE A1 (MA454), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF647 conjugate, 0.1mg/mL
BNC470253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF740 conjugate, 0.1mg/mL
BNC740031-500 1x 500 µL

Mucin 5AC (MUC5AC) (45M1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Aurora B (Proliferation Marker) (AURKB/1593), CF594 conjugate, 0.1mg/mL
BNC941593-500 1x 500 µL

Aurora B (Proliferation Marker) (AURKB/1593), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (T-Helper/Inducer Cell Marker) (RIV7), CF740 conjugate, 0.1mg/mL
BNC740362-500 1x 500 µL

CD4 (T-Helper/Inducer Cell Marker) (RIV7), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (B-Cell Marker) (rKLC264), CF405S conjugate, 0.1mg/mL
BNC042171-100 1x 100 µL

Human Kappa Light Chain (B-Cell Marker) (rKLC264), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details