Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Nuclear envelope phosphatase-regulatory subunit 1 (Cnep1r1)

This Recombinant Mouse Nuclear envelope phosphatase-regulatory subunit 1 (Cnep1r1) spans the amino acid sequence from region 1-125.

Product Specifications

Product Name Alternative

Nuclear envelope phosphatase-regulatory subunit 1, NEP1-R1, Transmembrane protein 188

UniProt

Q3UJ81

Expression Region

1-125

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSLEQAEDLKAFERRLTEYIHCLQPATGRWRMLLIVVSVCTATGAWNWLIDPETQKVSF FTSLWNHPFFTISCITLIGLFFAGIHKRVVAPSIIAARCRTVLAEYNMSCDDTGKLILKP RPHVQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Xenopus laevis Protein wntless homolog B (wls-b)
MBS7033619-01 0.02 mg

Recombinant Xenopus laevis Protein wntless homolog B (wls-b)

Sign In for Pricing
View Details
Recombinant Xenopus laevis Protein wntless homolog B (wls-b)
MBS7033619-02 0.1 mg

Recombinant Xenopus laevis Protein wntless homolog B (wls-b)

Sign In for Pricing
View Details
Recombinant Xenopus laevis Protein wntless homolog B (wls-b)
MBS7033619-03 5x 0.1 mg

Recombinant Xenopus laevis Protein wntless homolog B (wls-b)

Sign In for Pricing
View Details
Sheep IL6 Matched Antibody Pair Set [ABP-S-03979]
ABP-S-03979 5 Plates

Sheep IL6 Matched Antibody Pair Set [ABP-S-03979]

Sign In for Pricing
View Details
Human Poly (A) polymerase beta (PAPOLB) ELISA Kit
MBS281499-01 48 Tests

Human Poly (A) polymerase beta (PAPOLB) ELISA Kit

Sign In for Pricing
View Details
Human Poly (A) polymerase beta (PAPOLB) ELISA Kit
MBS281499-02 96 Tests

Human Poly (A) polymerase beta (PAPOLB) ELISA Kit

Sign In for Pricing
View Details