Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vibrio vulnificus Fumarate reductase subunit D (frdD)

This Recombinant Vibrio vulnificus Fumarate reductase subunit D (frdD) spans the amino acid sequence from region 1-125.

Product Specifications

Product Name Alternative

Fumarate reductase subunit D

UniProt

Q7MGX4

Expression Region

1-125

Origin

Vibrio vulnificus (strain YJ016)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKPNYNVDRAPKRSDEPVWWSLFGAGGTWFAMITPVTVLVLGILVPMGVINAEALSYDRV VSFATSIIGALFIIATLALPMWHAMHRVHHGMHDLKFHTGVVGKIACYAIAGLISALAVV FIFML

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (Fn-3), CF568 conjugate, 0.1mg/mL
BNC682848-100 1x 100 µL

Fibronectin (Fn-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF647 conjugate, 0.1mg/mL
BNC470977-500 1x 500 µL

TGF-beta (1D11.16.8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF405S conjugate, 0.1mg/mL
BNC040338-500 1x 500 µL

P53 (PAb122), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF594 conjugate, 0.1mg/mL
BNC940008-500 1x 500 µL

MAGE A1 (MA454), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF740 conjugate, 0.1mg/mL
BNC740146-100 1x 100 µL

CD10 (CB-CALLA), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details