Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Neurospora crassa Assembly factor cbp-4 (cbp-4)

This Recombinant Neurospora crassa Assembly factor cbp-4 (cbp-4) spans the amino acid sequence from region 1-125.

Product Specifications

Product Name Alternative

Assembly factor cbp-4, Cytochrome b mRNA-processing protein 4

UniProt

Q7SDU5

Expression Region

1-125

Origin

Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAKKPVNWWLWTKMLLGGAAICVGGPAFTYWLTPTDEELFQKYNPELQKRSLERRFERQ QEFDDFVTKLKEYSKSDKPIWTVQAEAEEKERQQRASVQKSLALADEVKARKEAMRREAG LPLEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Nitroso Prilocaine
TRC-N703590-50MG 50 mg

N-Nitroso Prilocaine

Sign In for Pricing
View Details
Mortality Factor 4 like 2 (MORF4L2) (C-term) Rabbit Polyclonal Antibody
AP52728PU-N 400 µL

Mortality Factor 4 like 2 (MORF4L2) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mitofusin 1 Recombinant Rabbit Monoclonal Antibody [JF0954]
ET1702-01 100 µL

Mitofusin 1 Recombinant Rabbit Monoclonal Antibody [JF0954]

Sign In for Pricing
View Details
N6-Isopentenyladenosine
TRC-I821840-25MG 25 mg

N6-Isopentenyladenosine

Sign In for Pricing
View Details
Imidazo[1,2-a]pyridine-6-carboxylic acid
TRC-I387580-500MG 500 mg

Imidazo[1,2-a]pyridine-6-carboxylic acid

Sign In for Pricing
View Details
CD3E Human Gene Knockout Kit (CRISPR)
KN208276 1 Kit

CD3E Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details