Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Neurospora crassa Assembly factor cbp-4 (cbp-4)

This Recombinant Neurospora crassa Assembly factor cbp-4 (cbp-4) spans the amino acid sequence from region 1-125.

Product Specifications

Product Name Alternative

Assembly factor cbp-4, Cytochrome b mRNA-processing protein 4

UniProt

Q7SDU5

Expression Region

1-125

Origin

Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAKKPVNWWLWTKMLLGGAAICVGGPAFTYWLTPTDEELFQKYNPELQKRSLERRFERQ QEFDDFVTKLKEYSKSDKPIWTVQAEAEEKERQQRASVQKSLALADEVKARKEAMRREAG LPLEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CACNA1C (NM_000719) Human Over-expression Lysate
LC424548 20 µg

CACNA1C (NM_000719) Human Over-expression Lysate

Sign In for Pricing
View Details
METTL21C (NM_001010977) Human Over-expression Lysate
LY423250 100 µg

METTL21C (NM_001010977) Human Over-expression Lysate

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (MUC1/967), CF594 conjugate, 0.1mg/mL
BNC940967-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (MUC1/967), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
(R)-Anabasine, > 98% ee
TRC-A637165-5MG 5 mg

(R)-Anabasine, > 98% ee

Sign In for Pricing
View Details
EMAP II (AIMP1) (137-149) Goat Polyclonal Antibody
AP31988PU-N 100 µg

EMAP II (AIMP1) (137-149) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Staufen (STAU1) Mouse Monoclonal Antibody [Clone ID: OTI3C5]
CF811475 100 µg

Staufen (STAU1) Mouse Monoclonal Antibody [Clone ID: OTI3C5]

Sign In for Pricing
View Details