Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial (NDUFB11)

This Recombinant Bovine NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial (NDUFB11) spans the amino acid sequence from region 30-154.

Product Specifications

Product Name Alternative

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial, Complex I-ESSS, CI-ESSS, NADH-ubiquinone oxidoreductase ESSS subunit

UniProt

Q8HXG5

Expression Region

30-154

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ESSSSRAVIAPSTLAGKRPSEPTLRWQEDPEPEDENLYEKNPDSHGYDKDPAVDIWNMRV VFFFGFSIVLVLGSTFVAYLPDYRMQEWARREAERLVKYREAHGLPIMESNCFDPSKIQL PEDED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SDAD1P1 3'UTR GFP Stable Cell Line
TU072774 1.0 mL

SDAD1P1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Clozapine N-oxide
BML-NS105-0025 25 mg

Clozapine N-oxide

Sign In for Pricing
View Details
Trimethoprim-d3
CS-CX-00757 1 Each

Trimethoprim-d3

Sign In for Pricing
View Details
Lentiviral human KIFC1 sgRNA gene knockout kit - Lentiviral human KIFC1 sgRNA gene knockout kit (100)
GTR15387700 1 Vial

Lentiviral human KIFC1 sgRNA gene knockout kit - Lentiviral human KIFC1 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
KLHL7 Human shRNA Lentiviral Particle (Locus ID 55975)
TL311876V 500 µL Each

KLHL7 Human shRNA Lentiviral Particle (Locus ID 55975)

Sign In for Pricing
View Details
ZNF343 HDR Plasmid (h)
sc-413150-HDR 20 µg

ZNF343 HDR Plasmid (h)

Sign In for Pricing
View Details