Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YCL021W-A (YCL021W-A)

This Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YCL021W-A (YCL021W-A) spans the amino acid sequence from region 1-125.

Product Specifications

Product Name Alternative

Putative uncharacterized protein YCL021W-A

UniProt

Q96VH3

Expression Region

1-125

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVLTDAEELRSPVITSDMSFFDLESNHSSDSVHLLCEKYTHKLPIESESQTTFRLAPTKQ RLYRQSTLYVPLSLKQRVFLFTERVKSIWAGLPRCKPNKYFKVAFALAVLTPLAIWIFYI DFRVH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eosinophil Peroxidase (AHE-1), CF405S conjugate, 0.1mg/mL
BNC041231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF740 conjugate, 0.1mg/mL
BNC740851-500 1x 500 µL

HSP60 (LK1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (KLC264), CF488A conjugate, 0.1mg/mL
BNC880264-100 1x 100 µL

Human Kappa Light Chain (KLC264), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (TRP/817), CF405S conjugate, 0.1mg/mL
BNC040817-500 1x 500 µL

P53 (TRP/817), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (LAMP3/968), CF640R conjugate, 0.1mg/mL
BNC400968-500 1x 500 µL

CD63 (LAMP3/968), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NKX2.2 (NX2/294), CF647 conjugate, 0.1mg/mL
BNC470294-500 1x 500 µL

NKX2.2 (NX2/294), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details