Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Brain protein I3 (Bri3)

This Recombinant Mouse Brain protein I3 (Bri3) spans the amino acid sequence from region 1-125.

Product Specifications

Product Name Alternative

Brain protein I3

UniProt

P28662

Expression Region

1-125

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDHKPLLQERPPAYNLEAGQGDYACGPHGYGAIPTAPPPPPYPYLVTGIPTSHPRVYNIH SRTVTRYPANSIVVVGGCPVCRVGVLEYCFTCLGIFLAIVLFPFGFLCCFALRKRRCPNC GAVFT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human RNASE3 Polyclonal Antibody
HY452024-01 50 µg

Anti-Human RNASE3 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Human RNASE3 Polyclonal Antibody
HY452024-02 100 µg

Anti-Human RNASE3 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Photorhabdus luminescens subsp. laumondii UPF0265 protein plu2843 (plu2843)
MBS1431421-01 0.02 mg (E-Coli)

Recombinant Photorhabdus luminescens subsp. laumondii UPF0265 protein plu2843 (plu2843)

Sign In for Pricing
View Details
Recombinant Photorhabdus luminescens subsp. laumondii UPF0265 protein plu2843 (plu2843)
MBS1431421-02 0.1 mg (E-Coli)

Recombinant Photorhabdus luminescens subsp. laumondii UPF0265 protein plu2843 (plu2843)

Sign In for Pricing
View Details
Recombinant Photorhabdus luminescens subsp. laumondii UPF0265 protein plu2843 (plu2843)
MBS1431421-03 0.02 mg (Yeast)

Recombinant Photorhabdus luminescens subsp. laumondii UPF0265 protein plu2843 (plu2843)

Sign In for Pricing
View Details
Recombinant Photorhabdus luminescens subsp. laumondii UPF0265 protein plu2843 (plu2843)
MBS1431421-04 0.1 mg (Yeast)

Recombinant Photorhabdus luminescens subsp. laumondii UPF0265 protein plu2843 (plu2843)

Sign In for Pricing
View Details