Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Brain protein I3 (BRI3)

This Recombinant Human Brain protein I3 (BRI3) spans the amino acid sequence from region 1-125.

Product Specifications

Product Name Alternative

Brain protein I3, pRGR2

UniProt

O95415

Expression Region

1-125

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDHKPLLQERPPAYNLEAGQGDYACGPHGYGAIPAAPPPPPYPYLVTGIPTHHPRVYNIH SRTVTRYPANSIVVVGGCPVCRVGVLEDCFTFLGIFLAIILFPFGFICCFALRKRRCPNC GATFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSAD (Center) Rabbit Polyclonal Antibody
AP51094PU-N 400 µL

CSAD (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tcl1 (TCL1A) (NM_001098725) Human Over-expression Lysate
LC420669 20 µg

Tcl1 (TCL1A) (NM_001098725) Human Over-expression Lysate

Sign In for Pricing
View Details
APOL3 (NM_145641) Human Over-expression Lysate
LY403433 100 µg

APOL3 (NM_145641) Human Over-expression Lysate

Sign In for Pricing
View Details
Smooth Muscle Actin (ACTA2/791 +1A4), CF405S conjugate, 0.1mg/mL
BNC041203-100 1x 100 µL

Smooth Muscle Actin (ACTA2/791 +1A4), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ARSB (359-372) Goat Polyclonal Antibody
AP08576PU-N 50 µg

ARSB (359-372) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Triflupromazine Hydrochloride
TRC-T793530-5G 5 g

Triflupromazine Hydrochloride

Sign In for Pricing
View Details