Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Brain protein I3 (BRI3)

This Recombinant Human Brain protein I3 (BRI3) spans the amino acid sequence from region 1-125.

Product Specifications

Product Name Alternative

Brain protein I3, pRGR2

UniProt

O95415

Expression Region

1-125

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDHKPLLQERPPAYNLEAGQGDYACGPHGYGAIPAAPPPPPYPYLVTGIPTHHPRVYNIH SRTVTRYPANSIVVVGGCPVCRVGVLEDCFTFLGIFLAIILFPFGFICCFALRKRRCPNC GATFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (TIMP2/2044), CF568 conjugate, 0.1mg/mL
BNC682044-500 1x 500 µL

TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (TIMP2/2044), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OXSR1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F3]
TA500392AM 100 µL

OXSR1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F3]

Sign In for Pricing
View Details
S100a3 Mouse Gene Knockout Kit (CRISPR)
KN515237 1 Kit

S100a3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LRRTM1 Mouse Monoclonal Antibody [Clone ID: OTI1C9]
CF805501 100 µg

LRRTM1 Mouse Monoclonal Antibody [Clone ID: OTI1C9]

Sign In for Pricing
View Details
HCK (NM_001172132) Human Over-expression Lysate
LY433198 100 µg

HCK (NM_001172132) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Il4ra activation kit by CRISPRa
GA202146 1 Kit

Mouse Il4ra activation kit by CRISPRa

Sign In for Pricing
View Details