Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Brain protein I3 (BRI3)

This Recombinant Human Brain protein I3 (BRI3) spans the amino acid sequence from region 1-125.

Product Specifications

Product Name Alternative

Brain protein I3, pRGR2

UniProt

O95415

Expression Region

1-125

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDHKPLLQERPPAYNLEAGQGDYACGPHGYGAIPAAPPPPPYPYLVTGIPTHHPRVYNIH SRTVTRYPANSIVVVGGCPVCRVGVLEDCFTFLGIFLAIILFPFGFICCFALRKRRCPNC GATFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1700001F09Rik (NM_027940) Mouse Tagged ORF Clone
MG201686 10 µg

1700001F09Rik (NM_027940) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
EGR1 Human Gene Knockout Kit (CRISPR)
KN209956RB 1 Kit

EGR1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MYBPC3 (NM_000256) Human Over-expression Lysate
LC424835 20 µg

MYBPC3 (NM_000256) Human Over-expression Lysate

Sign In for Pricing
View Details
Atp6v0b Mouse Gene Knockout Kit (CRISPR)
KN501810 1 Kit

Atp6v0b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS623479 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Scaffold attachment factor B2 (SAFB2) (345-357) Mouse Monoclonal Antibody [Clone ID: 6F7]
AM06059PU-N 50 µL

Scaffold attachment factor B2 (SAFB2) (345-357) Mouse Monoclonal Antibody [Clone ID: 6F7]

Sign In for Pricing
View Details