Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Fumarate reductase subunit D (frdD)

This Recombinant Fumarate reductase subunit D (frdD) spans the amino acid sequence from region 1-125.

Product Specifications

Product Name Alternative

Fumarate reductase subunit D

UniProt

P67644

Expression Region

1-125

Origin

Mycobacterium bovis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTPSTSDARSRRRSAEPFLWLLFSAGGMVTALVAPVLLLLFGLAFPLGWLDAPDHGHLLA MVRNPITKLVVLVLVVLALFHAAHRFRFVLDHGLQLGRFDRVIALWCYGMAVLGSATAGW MLLTM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal HGFR/c-MET Antibody (243) [Allophycocyanin]
NBP2-89295APC 0.1 mL

Rabbit Monoclonal HGFR/c-MET Antibody (243) [Allophycocyanin]

Sign In for Pricing
View Details
Int-6 siRNA (h)
sc-40561 10 µM

Int-6 siRNA (h)

Sign In for Pricing
View Details
NCALD siRNA (Human)
MBS8207305-01 15 nmol

NCALD siRNA (Human)

Sign In for Pricing
View Details
NCALD siRNA (Human)
MBS8207305-02 30 nmol

NCALD siRNA (Human)

Sign In for Pricing
View Details
NCALD siRNA (Human)
MBS8207305-03 5x 30 nmol

NCALD siRNA (Human)

Sign In for Pricing
View Details
KRT17 Antibody
CSB-PA012516KA01HU-100ul 100 µL

KRT17 Antibody

Sign In for Pricing
View Details