Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Fumarate reductase subunit D (frdD)

This Recombinant Fumarate reductase subunit D (frdD) spans the amino acid sequence from region 1-125.

Product Specifications

Product Name Alternative

Fumarate reductase subunit D

UniProt

P67644

Expression Region

1-125

Origin

Mycobacterium bovis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTPSTSDARSRRRSAEPFLWLLFSAGGMVTALVAPVLLLLFGLAFPLGWLDAPDHGHLLA MVRNPITKLVVLVLVVLALFHAAHRFRFVLDHGLQLGRFDRVIALWCYGMAVLGSATAGW MLLTM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM44 (NM_138399) Human Over-expression Lysate
E45H13750-2 20 µg

TMEM44 (NM_138399) Human Over-expression Lysate

Sign In for Pricing
View Details
COMPACT ALU PADLOCK 50MM SHA KD BLK/6 Keyed Padlocks & Safety Padlocks
834869 6 Pack (6 Piece (s) x 1 Pack)

COMPACT ALU PADLOCK 50MM SHA KD BLK/6 Keyed Padlocks & Safety Padlocks

Sign In for Pricing
View Details
DBX1 CRISPR Activation Plasmid (m)
sc-419955-ACT 20 µg

DBX1 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
RPAP2 Human Gene Knockout Kit (CRISPR)
KN407882 1 Kit

RPAP2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Olr786 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
34681066 1.0 µg DNA

Olr786 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Rebamipide Impurity 51
RM-R100035-01 10 mg

Rebamipide Impurity 51

Sign In for Pricing
View Details