Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rickettsia prowazekii Succinate dehydrogenase hydrophobic membrane anchor subunit (sdhD)

This Recombinant Rickettsia prowazekii Succinate dehydrogenase hydrophobic membrane anchor subunit (sdhD) spans the amino acid sequence from region 1-125.

Product Specifications

Product Name Alternative

Succinate dehydrogenase hydrophobic membrane anchor subunit

UniProt

P41086

Expression Region

1-125

Origin

Rickettsia prowazekii (strain Madrid E)

Field of Research

Metabolism Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIYDFKAEIIKAKNSSFSKSGSHHWLLQRVTGVILALCSFWLIYFMFTNKNNDINIIMWE FKKPFNIVILLITVTISLYHSVLGMRVVIEDYINCHKLRNTLIIIVKLFCILTIVSFVVA IFYSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD59 (heavy chain of Protectin) (BRA-10G), CF405S conjugate, 0.1mg/mL
BNC040181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF740 conjugate, 0.1mg/mL
BNC740008-100 1x 100 µL

MAGE A1 (MA454), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF405S conjugate, 0.1mg/mL
BNC041081-500 1x 500 µL

CD45RO (190-2F2.5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF647 conjugate, 0.1mg/mL
BNC470253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF740 conjugate, 0.1mg/mL
BNC740160-500 1x 500 µL

CD20 (B9E9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF555 conjugate, 0.1mg/mL
BNC551037-100 1x 100 µL

CD44 Standard (DF1485), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details