Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein ML1177 (ML1177)

This Recombinant Uncharacterized protein ML1177 (ML1177) spans the amino acid sequence from region 1-126.

Product Specifications

Product Name Alternative

Uncharacterized protein ML1177

UniProt

P54134

Expression Region

1-126

Origin

Mycobacterium leprae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTTRRRRPALVALVTIAACGCLALGWWQWTRFQSASGTFQNLGYALQWPLFAGFCLYTY HNFVRYEESPPQPRHMNCIAEIPPELLPARPKPEQQPPDDPALRKYNTYLAELAKQDAEN HNRTTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Hepcidin,Hepc ELISA KIT
JOT-EK0302Ca-01 48 Well

Canine Hepcidin,Hepc ELISA KIT

Sign In for Pricing
View Details
Canine Hepcidin,Hepc ELISA KIT
JOT-EK0302Ca-02 96 Well

Canine Hepcidin,Hepc ELISA KIT

Sign In for Pricing
View Details
IgA, kappa, Human Isotype Control (AP)
I1890-67K1 1 mL

IgA, kappa, Human Isotype Control (AP)

Sign In for Pricing
View Details
E2F7 Protein Vector (Mouse) (pPB-N-His)
PV174123 500 ng

E2F7 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Human ZNF181 qPCR Primer Pair
QH72725S 200 Tests

Human ZNF181 qPCR Primer Pair

Sign In for Pricing
View Details
Anti-Bovine Serum Albumin/BSA Monoclonal Antibody (1A228)
BY411045-01 50 µg

Anti-Bovine Serum Albumin/BSA Monoclonal Antibody (1A228)

Sign In for Pricing
View Details