Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein ML1177 (ML1177)

This Recombinant Uncharacterized protein ML1177 (ML1177) spans the amino acid sequence from region 1-126.

Product Specifications

Product Name Alternative

Uncharacterized protein ML1177

UniProt

P54134

Expression Region

1-126

Origin

Mycobacterium leprae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTTRRRRPALVALVTIAACGCLALGWWQWTRFQSASGTFQNLGYALQWPLFAGFCLYTY HNFVRYEESPPQPRHMNCIAEIPPELLPARPKPEQQPPDDPALRKYNTYLAELAKQDAEN HNRTTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRNAW5 Protein Vector (Human) (pPB-C-His)
PV140546 500 ng

TRNAW5 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Fcf1 3'UTR GFP Stable Cell Line
TU254540 1.0 mL

Fcf1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Anti Mouse CD183/CXCR3 Flow Cytometry Monoclonal Clone CXCR3173 FITC Ready To Use 100 Tests
IHMAAMSCD183CXCR3173CFITC100 100 Tests

Anti Mouse CD183/CXCR3 Flow Cytometry Monoclonal Clone CXCR3173 FITC Ready To Use 100 Tests

Sign In for Pricing
View Details
ClfA Antibody
CSB-PA753416ZA01SKW-01 50 μL

ClfA Antibody

Sign In for Pricing
View Details
ClfA Antibody
CSB-PA753416ZA01SKW-02 100 µL

ClfA Antibody

Sign In for Pricing
View Details
VEGFC (Flt4-L, FLT4 Ligand DHM, VEGF-C, VRP, Flt4 Ligand) discontinued
215870 200 µL

VEGFC (Flt4-L, FLT4 Ligand DHM, VEGF-C, VRP, Flt4 Ligand) discontinued

Sign In for Pricing
View Details