Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus licheniformis Large-conductance mechanosensitive channel (mscL)

This Recombinant Bacillus licheniformis Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-126.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

Q65E27

Expression Region

1-126

Origin

Bacillus licheniformis (strain DSM 13 / ATCC 14580)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWKEFKSFAIRGNVIDLAIGVIIGGAFGKIVTSLVNDLMMPLLGLLLGGLDFSALSFTFV DAEIKYGLFIQSIVNFFIISFSIFLFIRYISKLKKKDAEEEKAAPDPQEELLKEIRDLLK EQTNRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL
BNC680257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF640R conjugate, 0.1mg/mL
BNC400164-500 1x 500 µL

CD28 (204.12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF740 conjugate, 0.1mg/mL
BNC742853-100 1x 100 µL

CD54 / ICAM-1 (15.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF594 conjugate, 0.1mg/mL
BNC940225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2000), CF647 conjugate, 0.1mg/mL
BNC472000-100 1x 100 µL

Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2000), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD79a (B-Cell Marker) (ZL7-4), CF594 conjugate, 0.1mg/mL
BNC941627-100 1x 100 µL

CD79a (B-Cell Marker) (ZL7-4), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details