Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rickettsia conorii Succinate dehydrogenase hydrophobic membrane anchor subunit (sdhD)

This Recombinant Rickettsia conorii Succinate dehydrogenase hydrophobic membrane anchor subunit (sdhD) spans the amino acid sequence from region 1-126.

Product Specifications

Product Name Alternative

Succinate dehydrogenase hydrophobic membrane anchor subunit

UniProt

Q92J98

Expression Region

1-126

Origin

Rickettsia conorii (strain ATCC VR-613 / Malish 7)

Field of Research

Metabolism Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVYDFKAEIVKAKNSGSAKSGSHHWLLQRVTGIILALCSVWLIYFTLTNKNNDINIIMLW ELKKPFNVVALLITVVISLYHAMLGMRVVIEDYISYHKLRNTLIIIVQLFCIVTIVAFVV ALFYKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3'-hydroxy Lidocaine
orb2283061-01 500 µg

3'-hydroxy Lidocaine

Sign In for Pricing
View Details
3'-hydroxy Lidocaine
orb2283061-02 1 mg

3'-hydroxy Lidocaine

Sign In for Pricing
View Details
3'-hydroxy Lidocaine
orb2283061-03 5 mg

3'-hydroxy Lidocaine

Sign In for Pricing
View Details
3'-hydroxy Lidocaine
orb2283061-04 10 mg

3'-hydroxy Lidocaine

Sign In for Pricing
View Details
Mir467d Mouse qPCR Primer Pair (MI0005513)
MP300342 200 Reactions

Mir467d Mouse qPCR Primer Pair (MI0005513)

Sign In for Pricing
View Details
Lentiviral mouse Ints12 shRNA (UAS) - Lentiviral mouse Ints12 shRNA (UAS) (25)
GTR15238733 1 Vial

Lentiviral mouse Ints12 shRNA (UAS) - Lentiviral mouse Ints12 shRNA (UAS) (25)

Sign In for Pricing
View Details