Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vibrio cholerae serotype O1 Preprotein translocase subunit SecE (secE)

This Recombinant Vibrio cholerae serotype O1 Preprotein translocase subunit SecE (secE) spans the amino acid sequence from region 1-126.

Product Specifications

Product Name Alternative

Preprotein translocase subunit SecE

UniProt

Q9KV36

Expression Region

1-126

Origin

Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKANNAEAPDSSNAADTLKWVATFVLLVAAVVGNYLYGELSVVARAAGVIVLIAAALGVA ATTTKGKEAIVFARESRMEVRKVVWPTRQETMQTTLIVLAVSIVMALALWGIDGIMVRLV AFATGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGE A1 (MA454), CF488A conjugate, 0.1mg/mL
BNC880008-500 1x 500 µL

MAGE A1 (MA454), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF740 conjugate, 0.1mg/mL
BNC740276-500 1x 500 µL

TAG-72 / CA72.4 (B72.3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
WT1 (Wilm's Tumor 1) (6F-H2), CF568 conjugate, 0.1mg/mL
BNC680856-500 1x 500 µL

WT1 (Wilm's Tumor 1) (6F-H2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX9 / SRY-box 9 (SOX9/2387), CF647 conjugate, 0.1mg/mL
BNC472387-500 1x 500 µL

SOX9 / SRY-box 9 (SOX9/2387), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 19 (KRT19) (Pancreatic Stem Cell Marker) (KRT19/1959R), CF488A conjugate, 0.1mg/mL
BNC881959-500 1x 500 µL

Cytokeratin 19 (KRT19) (Pancreatic Stem Cell Marker) (KRT19/1959R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ATRX / RAD54 (Alpha Thalassemia Mental Retardation) (ATRX/2900R), CF405S conjugate, 0.1mg/mL
BNC042900-500 1x 500 µL

ATRX / RAD54 (Alpha Thalassemia Mental Retardation) (ATRX/2900R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details