Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ureaplasma parvum serovar 3 Putative phosphotransferase enzyme IIB component UU178 (UU178)

This Recombinant Ureaplasma parvum serovar 3 Putative phosphotransferase enzyme IIB component UU178 (UU178) spans the amino acid sequence from region 1-126.

Product Specifications

Product Name Alternative

Putative phosphotransferase enzyme IIB component UU178, EC= 2.7.1.69, Putative PTS system EIIB component

UniProt

Q9PQW5

Expression Region

1-126

Origin

Ureaplasma parvum serovar 3 (strain ATCC 700970)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQNLNNKQKTLIIFLGIITFGIFIIYFFTKAKKVSQIRNTHLIVSSNIPFSLNDFYNCIG SKNNLVNVDATINTLKIELKEINALNNEKLKVLGAKGIMCNQTKISIIFGDFCLELKELI KKDLFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FXYD5 Antibody (Center)
orb33154-01 50 µL

FXYD5 Antibody (Center)

Sign In for Pricing
View Details
FXYD5 Antibody (Center)
orb33154-02 100 µL

FXYD5 Antibody (Center)

Sign In for Pricing
View Details
CBP Antibody: Biotin
SPC-752D-BI 100 µg

CBP Antibody: Biotin

Sign In for Pricing
View Details
EXOC7 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
19569156 3x 1.0 µg DNA

EXOC7 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Recombinant Danio rerio Adrenodoxin-like protein, mitochondrial (fdx1l)
MBS1483108-01 0.02 mg (E-Coli)

Recombinant Danio rerio Adrenodoxin-like protein, mitochondrial (fdx1l)

Sign In for Pricing
View Details
Recombinant Danio rerio Adrenodoxin-like protein, mitochondrial (fdx1l)
MBS1483108-02 0.1 mg (E-Coli)

Recombinant Danio rerio Adrenodoxin-like protein, mitochondrial (fdx1l)

Sign In for Pricing
View Details