Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Preprotein translocase subunit SecE (secE)

This Recombinant Preprotein translocase subunit SecE (secE) spans the amino acid sequence from region 1-127.

Product Specifications

Product Name Alternative

Preprotein translocase subunit SecE

UniProt

P0A2D4

Expression Region

1-127

Origin

Salmonella typhi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSANTEAQGSGRGLEAMKWIVVAILLIVAIVGNYLYRDMMLPLRALAVVILIAAAGGVAL LTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS FITGLRF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Toll Like Receptor 4 (TLR4) ELISA Kit
RDR-TLR4-Mu-01 96 Tests

Mouse Toll Like Receptor 4 (TLR4) ELISA Kit

Sign In for Pricing
View Details
Mouse Toll Like Receptor 4 (TLR4) ELISA Kit
RDR-TLR4-Mu-02 48 Tests

Mouse Toll Like Receptor 4 (TLR4) ELISA Kit

Sign In for Pricing
View Details
RAGE Antibody
KC-2798-01 50 μL

RAGE Antibody

Sign In for Pricing
View Details
RAGE Antibody
KC-2798-02 100 µL

RAGE Antibody

Sign In for Pricing
View Details
RAGE Antibody
KC-2798-03 1 mL

RAGE Antibody

Sign In for Pricing
View Details
beta COP (COPB1) Rabbit Polyclonal Antibody
TA364685 100 µL

beta COP (COPB1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details